HORDB

ID: hor002183
Uniprot ID: P51463
Protein name: Insulin B chain
Gene name: INS
Organism: Selasphorus rufus (Rufous hummingbird) (Trochilus rufus)
Family: Insulin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Selasphorus (genus), Trochilidae (family), Apodiformes (order), Caprimulgimorphae, Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: AVNQHLCGSHLVEALYLVCGERGFFYSPKA
Length: 30
Propeptide: IQSLPLLALLALSGPGTSHAAVNQHLCGSHLVEALYLVCGERGFFYSPKARRDAEHPLVNGPLHGEVGDLPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN
Signal peptide: IQSLPLLALLALSGPGTSHA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002183_AF2.pdb

hor002183_ESM.pdb

Mass:	382727	Formula:	C150H226N40O41S2
Absent amino acids:	DIMTW	Common amino acids:	L
pI:	7.42	Basic residues:	4
Polar residues:	10	Hydrophobic residues:	12
Hydrophobicity:	26.67	Boman Index:	-1410
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	91
Instability Index:	2732.33	Extinction Coefficient cystines:	3105
Absorbance 280nm:	107.07